SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008370 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008370
Domain Number 1 Region: 88-191
Classification Level Classification E-value
Superfamily GINS helical bundle-like 5.75e-33
Family PSF3 C-terminal domain-like 0.00000116
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.31e-22
Family PSF3 N-terminal domain-like 0.0000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008370   Gene: ENSPPYG00000007407   Transcript: ENSPPYT00000008711
Sequence length 216
Comment pep:known chromosome:PPYG2:16:45584306:45595934:1 gene:ENSPPYG00000007407 transcript:ENSPPYT00000008711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAV
PQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFG
SQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQIGQ
NGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
Download sequence
Identical sequences A0A2J8VZJ5 Q5RDV0
ENSPPYP00000008370 ENSPPYP00000008370 XP_002826522.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]