SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008438 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008438
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.99e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008438
Domain Number - Region: 101-238
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0018
Family Outer membrane efflux proteins (OEP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008438   Gene: ENSPPYG00000007471   Transcript: ENSPPYT00000008782
Sequence length 302
Comment pep:known chromosome:PPYG2:16:55225863:55226771:1 gene:ENSPPYG00000007471 transcript:ENSPPYT00000008782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
SSPSASTAQTAQLQPNLVSASAAVLLTLQAAVDSSQAPESVPPAPITPTGEDVKPIDLTV
QVEFAAAEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGT
TEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKH
GM
Download sequence
Identical sequences H2NR92
XP_002826639.1.23681 ENSPPYP00000008438 9600.ENSPPYP00000008438 ENSPPYP00000008438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]