SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008484 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008484
Domain Number 1 Region: 1694-1766
Classification Level Classification E-value
Superfamily Homeodomain-like 1.37e-18
Family Homeodomain 0.0047
Further Details:      
 
Domain Number 2 Region: 2096-2165
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 2402-2470
Classification Level Classification E-value
Superfamily Homeodomain-like 1.15e-17
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 4 Region: 1611-1683
Classification Level Classification E-value
Superfamily Homeodomain-like 1.58e-16
Family Homeodomain 0.012
Further Details:      
 
Domain Number 5 Region: 2486-2531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000841
Family HkH motif-containing C2H2 finger 0.00072
Further Details:      
 
Domain Number 6 Region: 1016-1089
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000195
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 7 Region: 181-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000104
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 874-921
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000171
Family Classic zinc finger, C2H2 0.086
Further Details:      
 
Domain Number 9 Region: 1996-2019,2173-2198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000043
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 10 Region: 252-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000838
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008484
Domain Number - Region: 692-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000377
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 546-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00256
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 1450-1480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00641
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 833-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00754
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 2985-3018
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0137
Family HkH motif-containing C2H2 finger 0.056
Further Details:      
 
Domain Number - Region: 106-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0185
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 1786-1816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0369
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 433-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0772
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008484   Gene: ENSPPYG00000007513   Transcript: ENSPPYT00000008830
Sequence length 3164
Comment pep:novel chromosome:PPYG2:16:58818007:58997870:1 gene:ENSPPYG00000007513 transcript:ENSPPYT00000008830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNVLQTLSRGTASTSSNSASSFVVFDGANRRNRLSFNSEGVRANVAEGGRRLDFADESA
NKDNATAPEPNESTEGDDGGFVPHHQHAGSLCELGVGECPSGSGVECPKCDTVLGSSRSL
GGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGGSCVYCKSGQPHPRLAR
GESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQNLQNGGGEQVFSHTAGAAAA
AAAAAAAAANISSSCGAPSPTKPKTKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLL
QQNMTQIQHNRHLGLGSLPSPAEAELYQYYLAQNMNLPNLKMDSAASDAQFMMSGFQLDP
AGPMAAMTPALVGGEIPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTT
DNLDMLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLV
AHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQ
QHESGVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDL
GQIFTIRRCPSTDPEAIEDVEGPSETAADPEELAKDQEGGGEKDQGKWTASSSQAEKELT
DSPATSKRISFPGSSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHS
VQPMLRCPLCQDMLNNKIHLQLHLTHLHSVAPDCVEKLIMTVTTPEMVMPSSMFLPAAVP
DRDGNSNLEEAGKQPETSEDLGKNILPSASTEQSGDLKPSPADPGSVREDSGFLCWKKGC
NQVFKTSAALQTHFNEVHAKRPQLPVSDRHVYKYRCNQCSLAFKTIEKLQLHSQYHVIRA
ATMCCLCQRSFRTFQALKKHLETSHLELSEADIQQLYGGLLANGDLLAMGDPTLAEDHTI
IVEEDKEEESDLEDKQSPTGSDSGSVQEDSGSEPKRALPFRKGPNFTMEKFLDPSRPYKC
TVCKESFTQKNILLVHYNSVSHLHKLKRALQESATGQPEPTSSPDNKPFKCNTCNVAYSQ
SSTLEIHMRSVLHQTKARAAKLEAASGSSNGTGNSSSISLSSSTPSPVSTSGSNTFTTSN
PSSAGIAPSSNLLSQVPTESVGMPPLGNPIGANIASPSEPKEANRKKLADMIASRQQQQQ
QQQQQQQQAQTLAQAQAQVQAHLQQELQQQAALIQSQLFNPTLLPHFPMTTETLLQLQQQ
QHLLFPFYIPSAEFQLNPEVSLPVTSGALTLTGTGPGLLEDLKAQVQVPQQSHQQILPQQ
QQNQLSVAQSHSALLQPSQHPEKKNKLVIKEKEKESQRERDSAEGGEGNTGPKETLPDAL
KAKEKKELATGGSSEPSMLPPRIASDARGNATKALLENFGFELVIQYNENKQKVQKKNGK
TDQGENLEKLECDSCGKLFSNILILKSHQEHVHQNYFPFKQLERFAKQYRDHYDKLYPLR
PQTPEPPPPPPPPPPPPLPAAPPQPASTPAIPASAPPITSPTIAPAQPSVPLTQLSMPME
LPIFSPLMMQTMPLQTLPAQLPPQLGPVEPLPADLAQLYQHQLNPTLLQQQNKRPRTRIT
DDQLRVLRQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQRNKDSPYNFSN
PPITSLEELKIDSRPPSPEPPKQEYWGSKRSSRTRFTDYQLRVLQDFFDANAYPKDDEFE
QLSNLLNLPTRVIVVWFQNARQKARKNYENQGEGKDGERRELTNDRYIRTSNLNYQCKKC
SLVFQRIFDLIKHQKKLCYKDEDEEGQDDSQNEDSMDAMEILTPTSSSCSTPMPSQAYSA
PTPSANNTASSAFLQLTAEAEELATFNSKTEAGDEKPKLAEAPSAQPNQTQEKQGQPKPE
LQQQEQPEQKTNTPQQKLPQLASLPSLPQPPPQAPPPQCPLPQSSPSPSQLSHLPLKPLH
TSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQEHQQLHFLSAQNQFIHPQFLDRSLDMP
FMLFDPSNPLLASQLLSGAIPQIPASSATSPSTPTSTMNTLKRKLEEKASASPGENDSGM
GGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTR
ARERKGQFRAVGPAQAHRRCPFCRALFKAKTALEAHIRSRHWHEAKRAGYNLTLSAMLLD
CDGGLQMKGDIFDGTSFSHLPPSSSDGQGVPLSPVSKTMELSPRTLLSPSSIKVEGIEDF
ESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNE
GLTKVAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEGTVDYSETSSLADPCSPSPGASGS
AGKSGDSGDRPGQKRFRTQMTNLQLKVLKSCFNDYRTPTMLECEVLGNDIGLPKRVVQVW
FQNARAKEKKSKLSMAKHFGINQTSYEGPKTECTLCGIKYSARLSVRDHIFSQQHISKVK
DTIGSQLDKEKEYFDPATVRQLMAQQELDRIKKANEVLGLAAQQQGMFDNAPLQALNLPT
AYPALQGIPPVLLPGLNSPSLPGFTPSNTALTSPKPNLMGLPSTTVPSPGLPTSGLPNKP
SSASLSSPTPAQATMAMAPQQPPQQQQQPQVQQPPPPPAAQPPPTPQLPPQQQQQRKDKD
SEKVKEKEKAHKGKGEPLPVPKKEKGEAPTATAATISAPLPTMEYAVDPAQLQALQAALT
SDPTALLTSQFLPYFVPGFSPYYAPQIPGALQSGYLQPMYGMEGLFPYSPALSQALMGLS
PGSLLQQYQQYQQSLQEAIQQQRQLQQQQQQQKVQQQQPKASQTPVPPGAASPDKDPAKE
SPKPEEQKNAPREVSPLLPKPPEEPEAESKSADSLYDPFIVPKVQYKLVCRKCQAGFGDE
EAARSHLKSLCFFGQSVVNLQEMVLHVPTGGGGGGGGSGGGGGGGGGGSYHCLACESALC
GEEALSQHLESALHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSNDSPPP
PSAAAPSSASPHASRKSWPQVVSRASAAKPPSFPPLSSSSTVTSSSCSTSGVQPSMPTDD
YSEESDTDLSQKSDGPASPVEGPKDPSCPKDSGLTSVGTDTFRL
Download sequence
Identical sequences H2NRD3
ENSPPYP00000008484 ENSPPYP00000008484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]