SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008649 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008649
Domain Number 1 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000133
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000254
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008649
Domain Number - Region: 476-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000978
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 3-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.047
Family LIM domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008649   Gene: ENSPPYG00000007673   Transcript: ENSPPYT00000009002
Sequence length 539
Comment pep:known chromosome:PPYG2:16:77377668:77393072:1 gene:ENSPPYG00000007673 transcript:ENSPPYT00000009002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCRLCHGKFSSRSLRSISERAPGASMERPSAEERVLVRDFQRLLGVAVRQDPTLSPFV
CKSCHAQFYQCHSLLKSFLQRVNVSPAGRRKPCAKVGAQPPTGAEEGACLVDLITSSPQC
LHGLVGWVHGHAASCRALPHLQRTLSSEYCGVIQVVWGCDQGHDYTMDTSSSCKAFLLDS
ALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPSTDVAQPPSDSD
MVGPRSGFPPQPSLPLCRAPGQLGEKQVPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQN
AQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYK
CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVRN
YICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAETELDFA
CDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPPPGPPSPSVTTEGQAVKPEPT
Download sequence
Identical sequences H2NRU6
ENSPPYP00000008649 9600.ENSPPYP00000008649 XP_009249346.1.23681 ENSPPYP00000008649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]