SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008706 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008706
Domain Number 1 Region: 313-375
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.18e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 254-316
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.1e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 372-434
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.81e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 431-461
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000993
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 226-252
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000806
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008706   Gene: ENSPPYG00000007723   Transcript: ENSPPYT00000009060
Sequence length 461
Comment pep:known chromosome:PPYG2:16_random:8248717:8254845:1 gene:ENSPPYG00000007723 transcript:ENSPPYT00000009060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLDALLSDLETTTSHMPRPGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKPSATSATLELDRLMASLSDFRVQNHLPGSGPT
QPPVASSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKTIAGQVV
TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG
Download sequence
Identical sequences H2NS00
XP_002834074.1.23681 9600.ENSPPYP00000008706 ENSPPYP00000008706 ENSPPYP00000008706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]