SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009191 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009191
Domain Number 1 Region: 434-678
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.82e-48
Family ATP-dependent DNA ligase catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 688-831
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-36
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 89-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.34e-30
Family PARP-type zinc finger 0.000000976
Further Details:      
 
Domain Number 4 Region: 925-1007
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000654
Family DNA ligase 0.0000174
Further Details:      
 
Domain Number 5 Region: 258-497
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000000196
Family ATP-dependent DNA ligase DNA-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009191   Gene: ENSPPYG00000008176   Transcript: ENSPPYT00000009562
Sequence length 1009
Comment pep:known chromosome:PPYG2:17:29717950:29742188:1 gene:ENSPPYG00000008176 transcript:ENSPPYT00000009562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPFKILFPQTLRALSRKELCLFRKHHWPDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATCLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGICRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTIYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIKVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASPMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKASDLADMITRVIREGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMLTAKPS
TMKVGEKPAMKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMISATHVLGSRDKNAAAQQVSPEWIWACIRKRRLVAPC
Download sequence
Identical sequences H2NTC2
XP_002827302.1.23681 XP_009249782.1.23681 XP_009249783.1.23681 9600.ENSPPYP00000009191 ENSPPYP00000009191 ENSPPYP00000009191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]