SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009510 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009510
Domain Number 1 Region: 137-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-75
Family Nuclear receptor ligand-binding domain 0.00000000264
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009510   Gene: ENSPPYG00000008462   Transcript: ENSPPYT00000009891
Sequence length 460
Comment pep:novel chromosome:PPYG2:17:49066450:49096725:-1 gene:ENSPPYG00000008462 transcript:ENSPPYT00000009891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGAAWAACAHLYTETSLCDVCACVHPA
Download sequence
Identical sequences H2NU79
ENSPPYP00000009510 ENSPPYP00000009510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]