SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009517 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009517
Domain Number 1 Region: 416-609
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-68
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 129-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-19
Family Nuclear receptor 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009517   Gene: ENSPPYG00000008469   Transcript: ENSPPYT00000009898
Sequence length 612
Comment pep:known chromosome:PPYG2:17:49327112:49338329:1 gene:ENSPPYG00000008469 transcript:ENSPPYT00000009898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSVCIN
RNRCQQCRFECLSWACLRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPT
QHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNILAAQRHNEALNGLRQAP
SSYPPTWSPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANDPRQGSSKNVLLACPMNM
YPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMV
RFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTA
VVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMH
SEKLLSFRVDAQ
Download sequence
Identical sequences H2NU86
ENSPPYP00000009517 ENSPPYP00000009517 9600.ENSPPYP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]