SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009578 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009578
Domain Number 1 Region: 42-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000927
Family LIM domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009578   Gene: ENSPPYG00000008528   Transcript: ENSPPYT00000009961
Sequence length 84
Comment pep:known chromosome:PPYG2:17:53399031:53400316:-1 gene:ENSPPYG00000008528 transcript:ENSPPYT00000009961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACYCKPHFQQLFKSKGNYD
EGFGRKQHKELWAHKEVDPGTKTA
Download sequence
Identical sequences H2NUE2
9600.ENSPPYP00000009578 ENSPPYP00000009578 ENSPPYP00000009578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]