SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010167 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010167
Domain Number 1 Region: 422-481
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-18
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 
Domain Number 2 Region: 369-418
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000523
Family Erythroid transcription factor GATA-1 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010167   Gene: ENSPPYG00000009057   Transcript: ENSPPYT00000010571
Sequence length 580
Comment pep:known chromosome:PPYG2:18:33780906:33818207:1 gene:ENSPPYG00000009057 transcript:ENSPPYT00000010571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTDGGWCLPKRFGAASADASDSRVFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGGGG
AAGGGAAGPGGAGTAAAHVSARFPYSPSPPMANGAARVSGGGSSLAAMGGREPQYSSLSA
ARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLHSLQSRAGAPLPVPRG
PSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKRVP
SSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKP
KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNP
ENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences H2NW10
9600.ENSPPYP00000010167 ENSPPYP00000010167 ENSPPYP00000010167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]