SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010380 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000010380
Domain Number - Region: 879-953
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000302
Family Homeodomain 0.02
Further Details:      
 
Domain Number - Region: 305-329,411-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00124
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 1021-1057
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0022
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 956-994
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00287
Family Classic zinc finger, C2H2 0.063
Further Details:      
 
Domain Number - Region: 240-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0563
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010380   Gene: ENSPPYG00000009248   Transcript: ENSPPYT00000010792
Sequence length 1077
Comment pep:known chromosome:PPYG2:18:88847595:88926134:1 gene:ENSPPYG00000009248 transcript:ENSPPYT00000010792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQ
NSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVY
ANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPASTTGPTTSTPSTSCS
SSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVF
TGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKRWSKPRKRSLMEMEGK
EDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPSTKKRALQDLA
PPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPA
SSIKKQPDSPVGSTTSEEKKEPEKEKPPVAGDTEKIKEESEDSSEKFEPSTLYPYLREED
LDDSPKGGLDILKSLENTVSTAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQ
VQPSYAGGVKSLSSAEHNALLHSPGSLTPPPHKSNVSAMEELVEKVMGKVNIKKEERPPE
KEKSSPAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLK
AKVTNGCNNLGIITDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDPLAMLYKISNS
MLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLIL
QAQFASSLRETTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFL
KNLDTGHPVFFCNDCASQFRTASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLAN
KTLGPLGATEEDLGSTFQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLIYVTELEKQ
Download sequence
Identical sequences H2NWL5
ENSPPYP00000010380 ENSPPYP00000010380 XP_009250755.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]