SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010934 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010934
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-23
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010934   Gene: ENSPPYG00000009762   Transcript: ENSPPYT00000011360
Sequence length 139
Comment pep:known chromosome:PPYG2:19:19625519:19626660:-1 gene:ENSPPYG00000009762 transcript:ENSPPYT00000011360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLICVS
QLQIQFQGGFSSRRGCLEGSQGTQALRKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDA
TDFFGRVVIYHLRVLGEKV
Download sequence
Identical sequences H2NY55
ENSPPYP00000010934 XP_009251295.1.23681 9600.ENSPPYP00000010934 ENSPPYP00000010934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]