SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011015 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011015
Domain Number 1 Region: 120-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000177
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 58-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000726
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 30-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000714
Family LIM domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011015   Gene: ENSPPYG00000009838   Transcript: ENSPPYT00000011445
Sequence length 235
Comment pep:known chromosome:PPYG2:19:35153177:35173383:1 gene:ENSPPYG00000009838 transcript:ENSPPYT00000011445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STAERRLEGLTRELERALEARTARDYFGICIKCGLGIYGARQACQAMGSLYHTDCFTCDS
CGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFR
CSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRD
YHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPLPSPTVHVTEL
Download sequence
Identical sequences H2NYD4
ENSPPYP00000011015 ENSPPYP00000011015 9600.ENSPPYP00000011015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]