SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011382 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011382
Domain Number 1 Region: 142-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000114
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 1164-1213
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000114
Family Myb/SANT domain 0.0039
Further Details:      
 
Domain Number 3 Region: 176-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011382
Domain Number - Region: 838-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00163
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011382   Gene: ENSPPYG00000010178   Transcript: ENSPPYT00000011824
Sequence length 1350
Comment pep:known chromosome:PPYG2:19:48939904:48981026:-1 gene:ENSPPYG00000010178 transcript:ENSPPYT00000011824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQYSLGDEGALPSEMHLPSFSESQGLNCSDTLNRDLGPNTRDFLYADLSGLDPDRSLPT
PDMSSEVLEDNLDTLSLYSGKDSDSVKLLEEYADSESQASLQDLGLGVLKAKEADEGGRA
TSGSARKGKRQHSSPQNPLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKICSKAFKRQ
DHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVQHGLCILKEAPTEEEACGDSP
HAHESAGQLPPSSLRSLVPPEARSPGSLLPHRDLLRRIVSSIVHQKTPSPGPTLAGASDT
EGRNTACPCPASSGSSSCTPAGPPATPAALDTELPEEPRLPQKEPATDVFTAPNSRVAGN
GAPDPPEPEPEPDTALLQARSTAESWPEGGSVPACLPLFRGQMVPASSQPSSHSFQWLRN
LPGCPKSKGNNVFVVHKPSAVPSREGSECGLGLSSASPSEESPPGPGGGLEDALPFPPAL
LRAPGEALSDPRSASGEDDPCAPKKVKLDCDSFLCQNPGEPGLQEAQKPGGLPADALPLF
RQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQVAAASSQLPAPEGKPAALRPLQGPWP
QQPPPLAPGVDSLHAGPGNTEAEGSPARRRKTAPGVPREASPGSTRRDAKGGLKVAAFPT
PLAAPSLESSRNPDISSLAKQLRSSKGTLDLGDIFPSTGQRQTQLGGEEPPGASLPRKQA
PAENGAASRTTKGGKGPACSRGGGYRLLGNPRAPRFSGFRKEKAKMDMCCAASPSQVAMA
SFSSAGPPADPSKSKLTIFSRIQGGNIYRLPHPVKEENVAGGGNQQNGSPTDWTEPRSTF
VCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEPQVFGTEFCEPLRQVLRPEGDRHSPP
GAKKPLDPTAAAPLVVPQSIPVVPVTRHIGSMAMEQEKDGEERDSKESSQQRKRKKRPPP
STAGEPGPAGCHQSRLRSPMFLVDRLLKGLFQCSPYTPPPMLSPIREGSGVYFNTLCSTS
TQASPDQLISSMLDQVDGSFGICVVKDDTKISIEPHINIGSRFQAEIPELQERSLAGIDE
HVASLVWKPWGDMMINPETQDRVTELCNLACSSVMPGGGTNLELALHCLHEAQGNVQVAL
ETLLLRGPQKPWTHLLADYRYTGSDVWTPIEKRLFKKAFYAHKKDFYLIHKTIQTKTVAQ
CVEYYYIWKKMIKFDCGRAPGLEKRVKREPEEVERTEEKVPCSPRERPSHHPPPELKIKT
KSYRRESILSSSPNAVPKRTPELSGSAESQGIFPCRECERVFDKIKSRNAHMKRHRLQDH
VEPIIRVKWPVKPFQLKEKELGADIGPLQW
Download sequence
Identical sequences H2NZE2
ENSPPYP00000011382 9600.ENSPPYP00000011382 ENSPPYP00000011382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]