SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011509 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011509
Domain Number 1 Region: 241-412
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.26e-38
Family Nuclear receptor ligand-binding domain 0.0000000353
Further Details:      
 
Domain Number 2 Region: 107-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011509   Gene: ENSPPYG00000010280   Transcript: ENSPPYT00000011952
Sequence length 413
Comment pep:known chromosome:PPYG2:19:51908890:51915286:1 gene:ENSPPYG00000010280 transcript:ENSPPYT00000011952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRWCLERGGTWREVRGRSMSSPTTNSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPW
PGGPDPDVPGTDEAGSACSADWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFH
YNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQC
VLSEEQIRKKKIRKQQQQQSQSQSQSPAGPQGSCSSTSGPGASPGGSEAGSQGSGEGEGV
QLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIIS
VQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKD
DFHRADQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences H2NZR6
ENSPPYP00000011509 ENSPPYP00000011509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]