SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012320 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012320
Domain Number 1 Region: 115-362
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-68
Family Nuclear receptor ligand-binding domain 0.00000000116
Further Details:      
 
Domain Number 2 Region: 78-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000306
Family Nuclear receptor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012320   Gene: ENSPPYG00000011031   Transcript: ENSPPYT00000012801
Sequence length 462
Comment pep:known chromosome:PPYG2:20:41857488:41888790:1 gene:ENSPPYG00000011031 transcript:ENSPPYT00000012801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMADYSAALDPAYTTLEFENVQVLTMGNVLLPVRLSRFRHPLRHPWSVSGRVDSSPQGD
TSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCVQN
ERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMK
EQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVP
RHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLR
SQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQE
MLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPET
PQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
Download sequence
Identical sequences H2P201
ENSPPYP00000012320 ENSPPYP00000012320 9600.ENSPPYP00000012320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]