SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012523 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012523
Domain Number 1 Region: 236-294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.85e-17
Family Erythroid transcription factor GATA-1 0.00057
Further Details:      
 
Domain Number 2 Region: 185-233
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000157
Family Erythroid transcription factor GATA-1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012523   Gene: ENSPPYG00000011208   Transcript: ENSPPYT00000013016
Sequence length 397
Comment pep:known chromosome:PPYG2:20:60766244:60779994:-1 gene:ENSPPYG00000011208 transcript:ENSPPYT00000013016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLALAASPSQAAYADSGSFLHAPGAGSPMFVQPARVPSMLSYLSGCEPSPQSPELAA
RPGWAQTATADSSAFGPGSPHPPAAHPPGATVFPFAHSPSGPGSGGSAGGRDGSTYQGAL
LPREQFAAPLGRPVGTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLE
EFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAG
LCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNALASPSAVRSTDSSAATSKAKPSLESPVCPGPGTGPQASGQENDSLAPGHL
EFKFEPEDFAFPSTALSPQAGLSGALRQEAWCALALA
Download sequence
Identical sequences H2P2I9
ENSPPYP00000012523 ENSPPYP00000012523 9600.ENSPPYP00000012523 XP_002830553.2.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]