SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012998 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012998
Domain Number 1 Region: 29-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000246
Family LIM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 2-28
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000642
Family LIM domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012998   Gene: ENSPPYG00000011652   Transcript: ENSPPYT00000013527
Sequence length 76
Comment pep:known chromosome:PPYG2:22:19683535:19683762:1 gene:ENSPPYG00000011652 transcript:ENSPPYT00000013527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKCPACDKVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHDSKPYCYYPCYAAMF
GPKGFGRGGSERHTFK
Download sequence
Identical sequences H2P3V2
XP_002830990.2.23681 ENSPPYP00000012998 9600.ENSPPYP00000012998 ENSPPYP00000012998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]