SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013085 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013085
Domain Number 1 Region: 304-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-52
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000375
Family LIM domain 0.00045
Further Details:      
 
Domain Number 3 Region: 148-243
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000145
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 96-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000214
Family LIM domain 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013085
Domain Number - Region: 11-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0545
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013085   Gene: ENSPPYG00000011730   Transcript: ENSPPYT00000013618
Sequence length 579
Comment pep:known chromosome:PPYG2:22:26179965:26246378:1 gene:ENSPPYG00000011730 transcript:ENSPPYT00000013618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVMLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHIQNAGHPHALSTLDTKENLEGTLKRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLKSYDETVDIFSFGIVLCEI
IGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLED
SFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Download sequence
Identical sequences H2P438
ENSPPYP00000013085 9600.ENSPPYP00000013085 ENSPPYP00000013085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]