SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013328 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013328
Domain Number 1 Region: 204-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.96e-67
Family Nuclear receptor ligand-binding domain 0.000000000724
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013328   Gene: ENSPPYG00000011942   Transcript: ENSPPYT00000013867
Sequence length 474
Comment pep:known chromosome:PPYG2:22:41634755:41673499:1 gene:ENSPPYG00000011942 transcript:ENSPPYT00000013867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYKYLGSC
PGSYGSIIKDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLGGQARWPNGIEQSEAEVRIFHWLIQCTSVETVTELTELRXRPFPGF
ANLDLNDQVTLLKYGVYEAIFAMLSSVMNKGRGWLVAYGNGFITREFLKSLSGNRVFRDI
MEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQS
NHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences H2P4S5
9600.ENSPPYP00000013328 ENSPPYP00000013328 ENSPPYP00000013328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]