SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013418 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013418
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013418   Gene: ENSPPYG00000012032   Transcript: ENSPPYT00000013965
Sequence length 309
Comment pep:known chromosome:PPYG2:22_random:2700632:2702888:-1 gene:ENSPPYG00000012032 transcript:ENSPPYT00000013965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYSPGPPEVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLG
PLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLW
KRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDF
AMQLSSSMA
Download sequence
Identical sequences H2P511
ENSPPYP00000013418 9600.ENSPPYP00000013418 ENSPPYP00000013418 XP_002834685.1.23681 XP_009235108.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]