SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013461 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013461
Domain Number 1 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000171
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013461   Gene: ENSPPYG00000012073   Transcript: ENSPPYT00000014010
Sequence length 117
Comment pep:known chromosome:PPYG2:2a:4789232:4808412:-1 gene:ENSPPYG00000012073 transcript:ENSPPYT00000014010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGRARPCVIPENKEIPRAALNSVHEANGTEDERAVSRLQRRHSDVKVYKEFCDFYAK
FNMANALANTTCERCKGGFAPAEKIVNSNGELYHEQCSVCAQCFQQFPEGLFYEDVT
Download sequence
Identical sequences H2P553
9600.ENSPPYP00000013461 ENSPPYP00000013461 ENSPPYP00000013461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]