SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013522 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013522
Domain Number 1 Region: 239-301
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.1e-18
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 298-364
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 117-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000006
Family LIM domain 0.019
Further Details:      
 
Domain Number 4 Region: 178-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000632
Family LIM domain 0.0029
Further Details:      
 
Domain Number 5 Region: 360-388
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013522   Gene: ENSPPYG00000012124   Transcript: ENSPPYT00000014073
Sequence length 459
Comment pep:novel chromosome:PPYG2:2a:13193326:13232251:-1 gene:ENSPPYG00000012124 transcript:ENSPPYT00000014073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRGFSRAGAAQRSTWPAAEPQPPAARARQPRPGVPGPLRRREYLQPPALRREAEGLSH
QGSEEGAESGARPRERGAEPELGRLVDRTVSSWRLGWHFDFGAAEKPGVKMTERFDCHHC
NESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ
CTNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICH
RCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTA
CRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFN
CKKCSLSLVGRGFLTERDDILCPDCGKDMSEVNREKLLLVISHTDFYVFFLTQAILPSGF
FQPHRDFLLVLFSDTHVCLNPLVLCASSVPGKEKTRPRA
Download sequence
Identical sequences H2P5B1
ENSPPYP00000013522 ENSPPYP00000013522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]