SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013655 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013655
Domain Number 1 Region: 57-259
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.09e-71
Family alpha-catenin/vinculin 0.00000017
Further Details:      
 
Domain Number 2 Region: 672-861
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.28e-59
Family alpha-catenin/vinculin 0.00024
Further Details:      
 
Domain Number 3 Region: 506-629
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.37e-57
Family alpha-catenin/vinculin 0.00000158
Further Details:      
 
Domain Number 4 Region: 375-504
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.76e-47
Family alpha-catenin/vinculin 0.000000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013655   Gene: ENSPPYG00000012245   Transcript: ENSPPYT00000014211
Sequence length 905
Comment pep:known chromosome:PPYG2:2a:29728725:30824825:-1 gene:ENSPPYG00000012245 transcript:ENSPPYT00000014211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFK
AMDSF
Download sequence
Identical sequences A0A0P6JAV3 A0A2I2YNA1 A0A2I3HWP0 A0A2I3MBM2 A0A2I3REV6 A0A2J8TE81 A0A2K5DV61 A0A2K5HSW7 A0A2K5M2Y4 A0A2K5R707 A0A2K5WE01 A0A2K6AF61 A0A2K6EBB9 A0A2K6T5A0 F7A9R5 Q5R416 U3CHM8
ENSP00000418191 ENSP00000419295 ENSP00000444675 ENSP00000418191 ENSP00000419295 gi|55770846|ref|NP_004380.2| ENSMMUP00000000397 NP_001127048.1.23681 NP_001253272.1.72884 NP_004380.2.87134 NP_004380.2.92137 XP_001499507.1.31192 XP_002709733.1.1745 XP_003413756.1.64505 XP_003801282.1.62490 XP_003816647.1.60992 XP_004634201.1.9945 XP_004660596.1.11716 XP_004691639.1.23501 XP_004713910.1.18182 XP_004844693.1.39548 XP_005575521.1.63531 XP_005686825.1.57651 XP_005891889.1.15283 XP_006169256.1.99106 XP_006905293.1.64745 XP_007968251.1.81039 XP_010331701.1.74449 XP_010808362.1.76553 XP_010861563.1.44457 XP_011356376.1.92234 XP_011712057.1.29376 XP_011819118.1.43180 XP_011823717.1.47321 XP_011941406.1.92194 XP_012358123.1.23891 XP_015978935.1.101085 XP_016804352.1.37143 XP_016858892.1.92137 XP_017392181.1.71028 XP_018876617.1.27298 XP_019605579.1.88060 XP_020943861.1.46622 XP_021526646.1.9421 ENSPPYP00000013655 9600.ENSPPYP00000013655 9606.ENSP00000355398 ENSPPYP00000013655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]