SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013918 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013918
Domain Number 1 Region: 267-319
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000338
Family Myb/SANT domain 0.0000993
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013918
Domain Number - Region: 373-413
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0057
Family Erythroid transcription factor GATA-1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013918   Gene: ENSPPYG00000012461   Transcript: ENSPPYT00000014482
Sequence length 496
Comment pep:known chromosome:PPYG2:2a:68758937:68890148:-1 gene:ENSPPYG00000012461 transcript:ENSPPYT00000014482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSVLPLITDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLAD
KHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRLHNGILGIKYTYVF
CHIFQDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVW
DPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLY
RHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKS
LTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNG
AVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQS
EEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQV
CKNTLRLRQSKTAVCC
Download sequence
Identical sequences H2P6E2
9600.ENSPPYP00000013918 ENSPPYP00000013918 ENSPPYP00000013918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]