SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014234 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014234
Domain Number 1 Region: 129-155,183-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-67
Family Nuclear receptor ligand-binding domain 0.00000000235
Further Details:      
 
Domain Number 2 Region: 76-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-30
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014234   Gene: ENSPPYG00000012757   Transcript: ENSPPYT00000014814
Sequence length 422
Comment pep:known chromosome:PPYG2:2b:6084526:6085791:-1 gene:ENSPPYG00000012757 transcript:ENSPPYT00000014814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCLASNE
CEITKRRRKACQACRFTKCLRVGMLKEGMRLDRVRGGRQKYKRQPEVDPLPFPGPFPAGP
LAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTIS
WAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAG
LGELGAALLQLVQRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLE
YEAGRAGPGGGAERWRAGRLLLTLPLLRQTAGKVLPRFYGVKLEGKVPMHKLFLEMLEAM
MD
Download sequence
Identical sequences H2P793
ENSPPYP00000014234 ENSPPYP00000014234 9600.ENSPPYP00000014234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]