SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014240 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014240
Domain Number 1 Region: 210-273
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.53e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 43-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000481
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 129-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000157
Family LIM domain 0.00087
Further Details:      
 
Domain Number 4 Region: 6-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000143
Family LIM domain 0.0025
Further Details:      
 
Domain Number 5 Region: 100-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000068
Family LIM domain 0.0013
Further Details:      
 
Domain Number 6 Region: 172-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014240
Domain Number - Region: 269-298
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0132
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014240   Gene: ENSPPYG00000012763   Transcript: ENSPPYT00000014820
Sequence length 327
Comment pep:known chromosome:PPYG2:2b:6398357:6439541:1 gene:ENSPPYG00000012763 transcript:ENSPPYT00000014820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSNMSDALANAVCQRCQARFAPAERIVNSNGELYHEQCFVCAQCFRPFPEGLFYEFER
EYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRH
LCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFSCTHCGELCLPCHDKMG
VPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYNQLFG
DVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVCKRCYEKFPL
ELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences H2P799
ENSPPYP00000014240 9600.ENSPPYP00000014240 ENSPPYP00000014240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]