SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014940 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014940
Domain Number 1 Region: 521-680
Classification Level Classification E-value
Superfamily Lipocalins 8.12e-47
Family Rv2717c-like 0.0000685
Further Details:      
 
Domain Number 2 Region: 106-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.03e-20
Family THAP domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014940
Domain Number - Region: 401-495
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.068
Family MED7 hinge region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014940   Gene: ENSPPYG00000013356   Transcript: ENSPPYT00000015539
Sequence length 682
Comment pep:known chromosome:PPYG2:2b:134345572:134400449:-1 gene:ENSPPYG00000013356 transcript:ENSPPYT00000015539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPYGLAPPGRLPRPPARLPADAARGLLRPAGPKTPEPAAGEDAGGGGGGPAAGACASIL
PYGADAAGRPTSRAVSPPRSLPRGGPRAGGRLGPGPGCAAGPRPAMVICCAAVNCSNRQG
KGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLEDQHRL
LKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATSRGAAGWSPSSSGNP
MAKPESRRLKRAALQGEAAPRAAQEAASQEQTQQALERTPGDGLATTVAGSQGKAEASAT
DAGDESATSSIEGGVADKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREP
IDRKRPKKDVEPSCSGSSLGPDKGLAQSPPSSSLTVTPQKPSQSPSAPPADVTPKPATEA
VQSEHSDASPMSINEVILSASGACKLIDSLHSYCFSSRQNKSQVCCLREQVEKKNGELKS
LRQRVSRSDSQVRKLQEKLDELRRVSVPYPSGLLSPSREPPKMNPVVEPLSWMLGTWLSD
PPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKV
AFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTV
SMATTTQPMTQHLHVTYKKVTP
Download sequence
Identical sequences H2P971
ENSPPYP00000014940 ENSPPYP00000014940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]