SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015106 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015106
Domain Number 1 Region: 88-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-97
Family Nuclear receptor ligand-binding domain 0.0000000000403
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-16
Family Nuclear receptor 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015106   Gene: ENSPPYG00000013508   Transcript: ENSPPYT00000015709
Sequence length 393
Comment pep:novel chromosome:PPYG2:3:12850799:12895601:-1 gene:ENSPPYG00000013508 transcript:ENSPPYT00000015709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSD
EAVEERRALIKRKKRERIGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLP
GVLSSGCELPESLQAPSREEAAKWSQVRKDLCSVKVSLQLRGEDGSVWNYKPPADNGGKE
IFSLLPHMADMSTYMFKGIINFAKVISYFRDLPIEDQISLLKGATFELCQLRFNTVFNAE
TGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPG
VVQHRVVDQLQEKFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQ
DIHPFATPLMQELFGIAEVQNGATNLNKTAQPL
Download sequence
Identical sequences H2P9M1
ENSPPYP00000015106 ENSPPYP00000015106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]