SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015368 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015368
Domain Number 1 Region: 177-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000194
Family LIM domain 0.062
Further Details:      
 
Domain Number 2 Region: 237-304
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015368
Domain Number - Region: 300-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00357
Family LIM domain 0.022
Further Details:      
 
Domain Number - Region: 140-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0806
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015368   Gene: ENSPPYG00000013741   Transcript: ENSPPYT00000015981
Sequence length 859
Comment pep:novel chromosome:PPYG2:3:81780828:81904479:1 gene:ENSPPYG00000013741 transcript:ENSPPYT00000015981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKICLHCKCPQEEHMVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLK
PEQVHQYYSCLPEEKVPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFS
SQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVC
NELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFEC
ETVLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCC
AHCKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKG
KTEEPMLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGN
KMEQNQSQSPLQLLSQCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFI
KECREDYYPGRLRSQESYSDMSSQSFSETRGSIQVPKYEEEEEEEGGMSTQQCRTRHPIS
SLKYTEDMTPTEQTPRGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSE
KLSNMGTLNSSMQFRSAESVRSLLSAQQYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDF
DGGMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLASER
EAISRLKDRPPLRAREDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRW
GPYFAEYDWCSTCSSSSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLG
GRGQLHSRKRQKSKNCIIS
Download sequence
Identical sequences H2PAC0
ENSPPYP00000015368 ENSPPYP00000015368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]