SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015597 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015597
Domain Number 1 Region: 562-633
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000207
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 500-567
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000218
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015597
Domain Number - Region: 472-498
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015597   Gene: ENSPPYG00000013945   Transcript: ENSPPYT00000016218
Sequence length 676
Comment pep:known chromosome:PPYG2:3:100895328:100983561:-1 gene:ENSPPYG00000013945 transcript:ENSPPYT00000016218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGTGNNPEFEETRRVFATKMAKIHLQQQ
QQQLLQEETLPRGSRGPANGGGRLGPQARREVVGSKLSVDGAAKPPLAASTGAPGAVTTL
AAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESPATSEMSAFHQPGPCEDPSCLTHGDYY
DNLSLASPKWGDKPGVSPSIGLSVGSGWPGSLGSDPPLPKPCGDHPLNHRQLSLSSSRSS
EGSLGGQNSGIRGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPVLGPVQPRTPSVSAP
LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSNSAPSSSPAGLDSS
QQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGPVLLE
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVF
GAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLC
GHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAAC
GLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVK
RLEKRPSSTALHQHHF
Download sequence
Identical sequences H2PAY9
9600.ENSPPYP00000015597 ENSPPYP00000015597 XP_009237395.1.23681 ENSPPYP00000015597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]