SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015639 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015639
Domain Number 1 Region: 21-124
Classification Level Classification E-value
Superfamily Lysozyme-like 7.24e-35
Family C-type lysozyme 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015639   Gene: ENSPPYG00000013982   Transcript: ENSPPYT00000016260
Sequence length 124
Comment pep:known chromosome:PPYG2:3:104256284:104259609:1 gene:ENSPPYG00000013982 transcript:ENSPPYT00000016260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTRDGYTGFGLFQIRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAW
Download sequence
Identical sequences H2PB27
XP_009237440.1.23681 ENSPPYP00000015639 9600.ENSPPYP00000015639 ENSPPYP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]