SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015734 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015734
Domain Number 1 Region: 214-458
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-72
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-26
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015734   Gene: ENSPPYG00000014063   Transcript: ENSPPYT00000016355
Sequence length 460
Comment pep:known chromosome:PPYG2:3:123001593:123212802:1 gene:ENSPPYG00000014063 transcript:ENSPPYT00000016355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGCVIDKVTRNQCQECRFKKCIYVGMATDLVLD
DSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQ
KRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQ
IILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLS
SFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKL
LMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences H2PBB7
ENSPPYP00000015734 9600.ENSPPYP00000015734 ENSPPYP00000015734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]