SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015742 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015742
Domain Number 1 Region: 636-749
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-38
Family Bromodomain 0.000000663
Further Details:      
 
Domain Number 2 Region: 432-576
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.88e-20
Family N-acetyl transferase, NAT 0.0000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015742   Gene: ENSPPYG00000014072   Transcript: ENSPPYT00000016364
Sequence length 755
Comment pep:known chromosome:PPYG2:3:127318642:127430852:-1 gene:ENSPPYG00000014072 transcript:ENSPPYT00000016364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGGAGPGGCGAGAGAGAGAGPGALPPQPTALPPAPPQGSPCAAAAGGSGACGPATAV
AAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSP
TPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKE
EDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPA
KERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSL
PRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPEKRKMTDSHVL
EEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFH
VVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGG
ICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYF
KKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERK
QAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQ
QVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFT
NCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Download sequence
Identical sequences H2PBC4
ENSPPYP00000015742 ENSPPYP00000015742 9600.ENSPPYP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]