SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015813 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015813
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily HMG-box 3.93e-30
Family HMG-box 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015813   Gene: ENSPPYG00000014135   Transcript: ENSPPYT00000016438
Sequence length 240
Comment pep:known chromosome:PPYG2:3:140269329:140270051:1 gene:ENSPPYG00000014135 transcript:ENSPPYT00000016438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDE
AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLS
APEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSL
SCPSQHTHTHPSPTNPGYVVPCNCTTWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
Download sequence
Identical sequences H2PBI9
ENSPPYP00000015813 9600.ENSPPYP00000015813 ENSPPYP00000015813 XP_002814130.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]