SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016276 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016276
Domain Number 1 Region: 567-642
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 2.49e-29
Family VHP, Villin headpiece domain 0.0000342
Further Details:      
 
Domain Number 2 Region: 50-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.14e-17
Family LIM domain 0.00092
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.71e-16
Family LIM domain 0.00047
Further Details:      
 
Domain Number 4 Region: 179-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000779
Family LIM domain 0.003
Further Details:      
 
Domain Number 5 Region: 146-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000773
Family LIM domain 0.011
Further Details:      
 
Domain Number 6 Region: 20-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000119
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016276   Gene: ENSPPYG00000014567   Transcript: ENSPPYT00000016936
Sequence length 642
Comment pep:novel chromosome:PPYG2:4:4960480:5113873:1 gene:ENSPPYG00000014567 transcript:ENSPPYT00000016936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFICKACGCDLAEG
GFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKC
KSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEVKSVHWKPSSALGLQ
VYQPGQHGETLSVLKIQNWIHPHARPSATESRWQSQTGARAAQVSPNPLSSPSAQMQAKL
GGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTS
SPSSTGSVSLGRYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG
SESGRSTPSLSVLSDSKPPPSTYQQAPRHFHVPDTGVKDNIYRKPPIYRQHAARRSDGED
GSFDQDSRKQKSSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMARDSFHSRDPV
SVADEGPGHWEPGMLQRNANLAPCGADPDASWGMREYKIYPYDSLIVTNRIRVKLPKDVD
RTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Download sequence
Identical sequences H2PCT2
ENSPPYP00000016276 ENSPPYP00000016276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]