SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016573 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016573
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.7e-18
Family THAP domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016573
Domain Number - Region: 153-201
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0144
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016573   Gene: ENSPPYG00000014843   Transcript: ENSPPYT00000017248
Sequence length 222
Comment pep:known chromosome:PPYG2:4:78819756:78833135:1 gene:ENSPPYG00000014843 transcript:ENSPPYT00000017248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNH
HLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQ
KSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIS
Download sequence
Identical sequences H2PDM2
ENSPPYP00000016573 XP_002814926.1.23681 XP_002814927.1.23681 9600.ENSPPYP00000016573 ENSPPYP00000016573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]