SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016626 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016626
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-17
Family THAP domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016626   Gene: ENSPPYG00000014891   Transcript: ENSPPYT00000017303
Sequence length 903
Comment pep:known chromosome:PPYG2:4:86435477:86460531:1 gene:ENSPPYG00000014891 transcript:ENSPPYT00000017303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSCSAVGCSTRDTVLSRERGLSFHQFPTDTIQRSKWIRAVNRVDPRSKKIWIPGPGAI
LCSKHFQESDFESYGIRRKLKKGAVPSVSLYKIPQGVHLKGKARQKILKQPLPDNSQEVA
TEDHNYSLKTPLTIGAEKLAEVQQMLQVSKKRLISVKNYRMIKKRKSLRLIDALVEEKLL
SEETECLLRAQFSDFKWELYNWRETDEYSTEMKQFACTLYLCSSKVYDYVRKILKLPHSS
ILRTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLLIKSIPLKQQLQWDPSSHSLQ
GFMDFGLGKLDADETPLASETVLLMAVGIFGHWRTPLGYFFVNRASGYLQAQLLRLTIGK
LSDIGITVLAVTSDATAHSVQMAKALGIHIDGDDMKCTFQHPSSSSQQIAYFFDSCHLLR
LIRNAFQNFQSIQFINGIAHWQHLVDLVALEEQQLSNMERIPSTLANLKNHVLKVNCATQ
LFSESVASALEYLLSLDLPPFQNCIGTIHFLRLINNLFDIFNSRNCYGKGLKGPLLPETY
SKINHVLIEAKTIFVTLSDTSNNQIIKGKQKLGFLGFLLNAESLKWLYQNYVFPKVMPFP
YLLTYKFSHDHLELFLKMLRQVLVTSSSPTCMAFQKAYYNLETRYKFQDEVFLSKVSIFD
ISVARRKDLALWTVQRQYGVSVTKTLFHEEGICQDWSNCSLSEALLDLSDHRRNLICDAG
YVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCRVINICERVVR
THSRMAIFELVPKQRELYLQQKILYELSGHIDLFVDVNKHLFDGEVCAINHFVKLLKDII
ICFLNIRAKNVAQNPLKHHSERTDMKTLSRKHWSSLQDYKCSSFANTSSKFRHLLSNDGY
PFK
Download sequence
Identical sequences H2PDS3
ENSPPYP00000016626 9600.ENSPPYP00000016626 ENSPPYP00000016626 XP_002814975.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]