SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016679 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016679
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.0000791
Further Details:      
 
Domain Number 2 Region: 505-569
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.8e-17
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 446-508
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 4 Region: 413-444
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000024
Family LIM domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016679
Domain Number - Region: 564-592
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016679   Gene: ENSPPYG00000014937   Transcript: ENSPPYT00000017358
Sequence length 596
Comment pep:known chromosome:PPYG2:4:98509841:98729002:1 gene:ENSPPYG00000014937 transcript:ENSPPYT00000017358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGISAQG
MTHLEAQNKIKGCTGSLNMTLQRASATPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTST
NNMAYNKAPRPFGSMSSPKVTSIPSPSSAFTPAHATTSSRASPSPVAAVTPPQFAASGLH
ANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQGDSKQQNGPPR
KHIVERYTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEA
DNTKKANNSQEPSPQLASSVASTRSMPESLDSPASGRPGVASLTTAAAFKPVGSTGVIKS
PSWQRPNQGVPSTGRISNSAAYSGSVAPANSASGQTQPSDQDTLVQRAEHIPAGKRTPMC
AHCNQVIRGPFLVALGKSWHPEEFNCSHCKNTMAYIGFVEEKGALYCELCYEKFFAPECG
RCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHG
CEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF
Download sequence
Identical sequences H2PDX4
ENSPPYP00000016679 XP_002815023.1.23681 9600.ENSPPYP00000016679 ENSPPYP00000016679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]