SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016864 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016864
Domain Number 1 Region: 15-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.86e-44
Family APC10-like 0.000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016864   Gene: ENSPPYG00000015096   Transcript: ENSPPYT00000017545
Sequence length 161
Comment pep:known chromosome:PPYG2:4:150508016:150627873:-1 gene:ENSPPYG00000015096 transcript:ENSPPYT00000017545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPNKTPPGADPKQFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYK
SDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLAN
HQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Download sequence
Identical sequences H2PEE8
ENSPPYP00000016864 ENSPPYP00000016864 9600.ENSPPYP00000016864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]