SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016987 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016987
Domain Number 1 Region: 79-164
Classification Level Classification E-value
Superfamily HMG-box 2.49e-31
Family HMG-box 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 3.53e-27
Family HMG-box 0.00000728
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016987
Domain Number - Region: 186-209
Classification Level Classification E-value
Superfamily ARM repeat 0.0196
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016987   Gene: ENSPPYG00000015204   Transcript: ENSPPYT00000017674
Sequence length 210
Comment pep:known chromosome:PPYG2:4:180332137:180335169:-1 gene:ENSPPYG00000015204 transcript:ENSPPYT00000017674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEEEDEDEEEEDEDEE
Download sequence
Identical sequences A0A096MR30 A0A2K5YZI9 H2PER9 I7GNV9
ENSPPYP00000016987 ENSPPYP00000016987 ENSPANP00000002224 9600.ENSPPYP00000016987 NP_001271844.1.63531 XP_002815341.1.23681 XP_003776594.1.23681 XP_004682455.1.23501 XP_007101604.1.24612 XP_007101605.1.24612 XP_011841474.1.47321 XP_011841476.1.47321 XP_011841477.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]