SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017038 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017038
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-24
Family PDZ domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 240-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000102
Family LIM domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017038
Domain Number - Region: 178-273
Classification Level Classification E-value
Superfamily FdhE-like 0.0235
Family FdhE-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017038   Gene: ENSPPYG00000015251   Transcript: ENSPPYT00000017730
Sequence length 286
Comment pep:novel chromosome:PPYG2:4:193764318:193798451:-1 gene:ENSPPYG00000015251 transcript:ENSPPYT00000017730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESM
THADAQDRIKAAAHQLCLKIDRGETRLWSPQVSEDGKAHPFKINLESEPQEFRPIGTAHN
RRAQPFVAAANIDDKRQVVSASYNSPIGLYSTSNIQDALHGQLRGLIPSSPQNEPTASVP
PESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTKVHGGSGGA
QRMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKATSS
Download sequence
Identical sequences H2PEW7
ENSPPYP00000017038 ENSPPYP00000017038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]