SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017473 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017473
Domain Number 1 Region: 70-325
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-71
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017473   Gene: ENSPPYG00000015629   Transcript: ENSPPYT00000018181
Sequence length 339
Comment pep:known chromosome:PPYG2:5:94166530:94175096:1 gene:ENSPPYG00000015629 transcript:ENSPPYT00000018181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCR
LKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSR
YGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVL
NAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCL
KAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSS
SVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences H2PG31
9600.ENSPPYP00000017473 ENSPPYP00000017473 ENSPPYP00000017473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]