SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017700 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017700
Domain Number 1 Region: 58-260
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.16e-68
Family alpha-catenin/vinculin 0.00000000801
Further Details:      
 
Domain Number 2 Region: 507-630
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.67e-58
Family alpha-catenin/vinculin 0.00000053
Further Details:      
 
Domain Number 3 Region: 672-861
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.28e-56
Family alpha-catenin/vinculin 0.00027
Further Details:      
 
Domain Number 4 Region: 376-505
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.83e-47
Family alpha-catenin/vinculin 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017700   Gene: ENSPPYG00000015832   Transcript: ENSPPYT00000018413
Sequence length 905
Comment pep:known chromosome:PPYG2:5:140313799:140493769:1 gene:ENSPPYG00000015832 transcript:ENSPPYT00000018413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGELAYALNNFDKQIIVDPLSFSEERF
RPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKERS
DALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQ
VFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQ
ENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRT
AGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSD
PAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAST
KYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFK
AMDSI
Download sequence
Identical sequences H2PGP5
9600.ENSPPYP00000017700 ENSPPYP00000017700 ENSPPYP00000017700 XP_002815983.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]