SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017823 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017823
Domain Number 1 Region: 177-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.04e-16
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 106-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.84e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 49-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000504
Family LIM domain 0.0023
Further Details:      
 
Domain Number 4 Region: 236-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000927
Family LIM domain 0.0021
Further Details:      
 
Domain Number 5 Region: 607-651
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 0.00000000894
Family VHP, Villin headpiece domain 0.00016
Further Details:      
 
Domain Number 6 Region: 144-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000508
Family LIM domain 0.0011
Further Details:      
 
Domain Number 7 Region: 19-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000824
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017823   Gene: ENSPPYG00000015931   Transcript: ENSPPYT00000018538
Sequence length 705
Comment pep:novel chromosome:PPYG2:5:151061929:151181961:1 gene:ENSPPYG00000015931 transcript:ENSPPYT00000018538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPACARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPVYSPDPY
YASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLENHPQPDAIMEAASL
SLVKNLARLKGFCYCCWIFLFPIKAHHFNPKPVSFCCFLCGSGND
Download sequence
Identical sequences H2PH09
ENSPPYP00000017823 ENSPPYP00000017823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]