SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018011 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018011
Domain Number 1 Region: 7-87
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 2 Region: 333-397
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.53e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 274-337
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-18
Family LIM domain 0.028
Further Details:      
 
Domain Number 4 Region: 244-272
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000642
Family LIM domain 0.0047
Further Details:      
 
Domain Number 5 Region: 393-418
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000526
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018011   Gene: ENSPPYG00000016095   Transcript: ENSPPYT00000018730
Sequence length 423
Comment pep:known chromosome:PPYG2:5:180179589:180193977:-1 gene:ENSPPYG00000016095 transcript:ENSPPYT00000018730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKVQTPDKQPLRPLVPDASKQRLMENTED
WRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQETWPGPT
APSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGS
NNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYD
VRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKMPIRNRAFYMEEGVPYCERDYEK
MFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAF
SHV
Download sequence
Identical sequences H2PHI7
XP_002816328.1.23681 ENSPPYP00000018011 ENSPPYP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]