SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018484 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018484
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-86
Family Nuclear receptor ligand-binding domain 0.000000000146
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018484   Gene: ENSPPYG00000016527   Transcript: ENSPPYT00000019221
Sequence length 441
Comment pep:known chromosome:PPYG2:6:35416709:35433730:1 gene:ENSPPYG00000016527 transcript:ENSPPYT00000019221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSQSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFGDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQLMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences H2PIT1
XP_009240055.1.23681 XP_009240056.1.23681 ENSPPYP00000018484 ENSPPYP00000018484 9600.ENSPPYP00000018484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]