SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018529 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018529
Domain Number 1 Region: 138-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.88e-19
Family AN1-like Zinc finger 0.0011
Further Details:      
 
Domain Number 2 Region: 18-68
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000171
Family A20-like zinc finger 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018529   Gene: ENSPPYG00000016566   Transcript: ENSPPYT00000019267
Sequence length 227
Comment pep:known chromosome:PPYG2:6:37904732:38225729:1 gene:ENSPPYG00000016566 transcript:ENSPPYT00000019267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF
SEETTSDNNNTSITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGT
DSQSENEASPVKRPRLLENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVF
CMLHRLPEQHDCTFDHMGRGREEAIMKMVKLDRKVGRSCQRIGEGCS
Download sequence
Identical sequences A0A024RD12 A0A2K5CQ66 F7HWW1 G1RKI2 H2PIX2 K7B9Q7 Q9H8U3
ENSP00000287218 ENSNLEP00000013739 ENSPPYP00000018529 ENSCJAP00000010420 NP_068762.1.87134 NP_068762.1.92137 XP_002746546.1.60252 XP_002816882.1.23681 XP_003276964.1.23891 XP_009449458.2.37143 XP_012602243.1.48125 XP_021521183.1.9421 ENSP00000287218 9600.ENSPPYP00000018529 9606.ENSP00000287218 ENSNLEP00000013739 gi|11345484|ref|NP_068762.1| ENSPPYP00000018529 ENSCJAP00000010420 ENSP00000287218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]