SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018581 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018581
Domain Number 1 Region: 806-854
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000162
Family Myb/SANT domain 0.007
Further Details:      
 
Domain Number 2 Region: 930-954,998-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000388
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018581
Domain Number - Region: 512-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00432
Family Plant C2H2 finger (QALGGH zinc finger) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018581   Gene: ENSPPYG00000016614   Transcript: ENSPPYT00000019320
Sequence length 1115
Comment pep:known chromosome:PPYG2:6:42347233:42389100:-1 gene:ENSPPYG00000016614 transcript:ENSPPYT00000019320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQD
TRDGLGLPVGSKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAPAEPTDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSA
LRQLLSQKPVEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPL
AQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQQRISMQEIQTQPQQIRPSQP
QPPPPQQQPPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPSYHRDPHQYT
PEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAM
LSSHGDLGPPDTGMGDPASSDLTRVSSALPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQ
MHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHGGMRA
SPNLKQEIPRKHQPSVPKAEEPLKTVQEKKKFRHRPEPLFIPPPPSYNPNPAASYSGATL
YQSQLRSPRVLGDHLLLDPTHELPPYTPPPMLSPVRQGSGLFSNVLISGHGPGAHPQLPL
TPLTPTPRVLLCRSNSIDGSNVTITPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQ
DTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPGGGTNSEFALHSLFEAKGDVMVA
LEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFIFVQKMVKSKTVA
QCVEYYYTWKKIMRLGRKHRTRLAEIIDDCVTSEEEEELEEEEEDPEEDRKSTKEEESEV
PKSPEPPPVPVLAPTEGPPLQALGQPSGSFICEMPNCGAVFSSRQALNGHARIHGGTNQV
TKARGAIPSGKQKPGGTQSGYCSVRSSPSHSTTSGETDPTTIFPCKECGKVFFIKSRNAH
MKTHRQQEEQQRSDQKAAFAADMAATIERTTGPVGAPGLLPLDQLSLIKPIKDVDILDDD
VVQQLGGVMEEAEVVDTDLLLDDQDSVLLQGDAEL
Download sequence
Identical sequences H2PJ22
9600.ENSPPYP00000018581 ENSPPYP00000018581 ENSPPYP00000018581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]