SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018612 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018612
Domain Number 1 Region: 31-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000157
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000357
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000555
Family LIM domain 0.011
Further Details:      
 
Domain Number 4 Region: 4-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000173
Family LIM domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018612   Gene: ENSPPYG00000016638   Transcript: ENSPPYT00000019351
Sequence length 204
Comment pep:known chromosome:PPYG2:6:43386627:43389647:-1 gene:ENSPPYG00000016638 transcript:ENSPPYT00000019351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGA
LFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGE
TSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYL
FGPKGVNIGDVGCYIYDPVKIKFK
Download sequence
Identical sequences H2PJ52
ENSPPYP00000018612 NP_996805.2.87134 NP_996805.2.92137 ENSPPYP00000018612 9600.ENSPPYP00000018612 9606.ENSP00000361650 gi|116517305|ref|NP_996805.2| ENSP00000361650 ENSP00000361650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]